Target Country:
US Products, US Companies, US Trade Leads
UK Products, UK Companies, UK Trade Leads
Australian  Suppliers, Importers, Exporters, Manufacturers Belgium  Suppliers, Importers, Exporters, Manufacturers Canadian Suppliers, Importers, Exporters, Manufacturers China Suppliers, Importers, Exporters, Manufacturers German  Suppliers, Importers, Exporters, Manufacturers Indian  Suppliers, Importers, Exporters, Manufacturers Italian  Suppliers, Importers, Exporters, Manufacturers Netherlands Suppliers, Importers, Exporters, Manufacturers New Zealand Suppliers, Importers, Exporters, Manufacturers Turkey  Suppliers, Importers, Exporters, Manufacturers United Kingdom UK  Suppliers, Importers, Exporters, Manufacturers US Suppliers, Importers, Exporters, Manufacturers
Importers Exporters
Buyers Selllers
Manufacturers Distributors
Login Now! Username is your contact e-mail address! Forgot Password? Or have a Login Problem with your account and Need Help? | FREE BUSINESS WEBSITE: Register Now!
All Buyers | Auto Parts | Battery | Chemicals | Cement | Electronics | Iron Ore | Mobile Phones | Sugar | Textile | Wood | All Sellers
China products >>> Hot Products - Made in China , US, UK and More, Products Made in US, UK, Canada, India, Italy, Australia, Germany Canada, India, Italy, Australia, Germany
Trade Leads Directory -> All Trade Leads -> Chemicals -> Pharmaceutical Products -> GHRH 1-44
B2B TradeHolding.com - View Trade Lead - GHRH 1-44
Australia Trade Leads, Buyers, Sellers Belgium Trade Leads, Buyers, Sellers Canada Trade Leads, Buyers, Sellers China Trade Leads, Buyers, Sellers Germany Trade Leads, Buyers, Sellers India Trade Leads, Buyers, Sellers Ireland Trade Leads, Buyers, Sellers Italy Trade Leads, Buyers, Sellers Netherlands Trade Leads, Buyers, Sellers New Zealand Trade Leads, Buyers, Sellers Turkey Trade Leads, Buyers, Sellers UK Trade Leads, Buyers, Sellers US Trade Leads, Buyers, Sellers Quick Search    Home    Site Map    Terms of Service    Help
Join FREE!   
Agents  Buying Offices  Distributors / Wholesalers  Importers / Exporters  Manufacturers  Trading Companies

GHRH 1-44 (Offer to Sell)

Peptide4u
 Top Member - Become a Top MemberRespond Online Now!
Get Contact Details Now!


Trade Lead Description:

Sequence YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2

Molecular Formula
C 215 H 358 N 72 O66 S

Molecular Weight
5039.76

Purity (HPLC)
95%

Description
A peptide of 44 amino acids in most species that stimulates the release and synthesis of GROWTH HORMONE. GHRF (or GRF) is synthesized by neurons in the ARCUATE NUCLEUS of the HYPOTHALAMUS. After being released into the pituitary portal circulation, GHRF stimulates GH release by the SOMATOTROPHS in the PITUITARY GLAND.
Type of Offer: Offer to Sell
Quantity: 1Gm
Packaging: 10mg
Price / Incoterms Conditions: Not Specified

Posted from China - Shanghai on 19 November, 2015
Contact Information

Join Now or Login
to contact Trade Lead Poster!

 
Company Details
Company Name: Peptide4u Top Member - Become a Top Member
Contact Person: George Lu
Location: China - Shanghai
Hotels in Shanghai, China
Companies from China
Trade Leads from China
Products from China
Classification: Chemicals - Pharmaceutical Products
Similar Trade Leads:
-->> More GHRH 1-44 Trade Leads
Related Site Sections:
* Company Directory: Chemicals - Pharmaceutical Products
* Biz Keywords: Chemicals - Pharmaceutical Products
* Product Showroom: Chemicals - Pharmaceutical Products
* Latest Business News
View More Trade Leads
Search For:

B2B TradeHolding.com or and exact phrase
Contact Now!
Peptide4u
Top Member - Become a Top Member Member Website
21 Trade Leads posted
1 Product on sale
Members Login
 E-Mail Address:
 
 Password:
 
  Store my password
 Forgot password?
 Can't login?

 Not a member?
 Register for FREE!

Browse by Continent
Browse by Continent

Advertisement


What's New?

Companies
Products
Trade Leads
Buying Requests
Selling Offers
Opportunities
Popular Searches
pharmaceutical products buyers
vitamin buyers
b1 buyers
b2 buyers
b5 buyers
b12 buyers
c buyers
nicotinamide buyers
medicine buyers
veterinary products buyers
paracetamol buyers
Quick Links
  Home
  Browse by Country
  Browse Trade Leads
  Browse Companies
  Browse Products
  Top Products
  Top Searches
  Top Sites
  Browse Biz Keywords
  Partner / Trade Links
Advertisement



Regional Resources
  US, Canada Buyers
  UK, Europe Buyers
  South America Buyers
  China, Asia Buyers
  Australia Buyers
More Resources
Company Directory
Trade Lead Directory
Product Directory
Business Opportunities | Apparel | Beauty | Furniture | Health Care | MP3, DVD, VCD | Shoes | Phones | Sugar | Textile | Wire
References: US Trade Leads - US B2b Marketplace - Top Products - More countries: Browse by Country
US products Made in USCanada products Made in CanadaUK products Made in UKChina products Made in China
Made in Europe Made in America Made in Asia Made in Africa
What is TTL? Targeted Trade Leads is a new optional online e-mail service we provide to Wholesale Suppliers on demand. By using this service you can easily send tens, hundreds or even thousands of buy sell offers to importer exporter companies, directly to their Inbox! You can send TTL to Importers Exporters by Industrial Categories.
bearings | chemicals | coffee | fats, oil | food | handicraft | hms | meat | metals | steel | stone, jewelry, gold | urea | vegetable
Step 1: Select country or countries for your targeted buy - sell offers.
Step 2: Select industrial category / categories for your import - export demands.
Step 3: View how many companies will receive it based on your selection.
Step 4: Enter your offer you wish to email to interested suppliers or buyers.
Step 5: Receive confirmation of delivered Targeted Trade Leads by e-mail.
Finally Just expect the replies immediately in your mailbox! Even by phone or fax.

Premium
Business Opportunities
US, Canada, UK, China, India, Malaysia, United Arab Emirates, Australia and New Zealand Companies
Company Directory - Importers & Exporters by Industry: Animal Products, Automobile, Base Metals & Articles, Chemicals, Computers & Software, Construction, Consumer Electronics, Energy & Environment, Fats & Oils, Food, Footwear & Headgears, Health & Beauty, Hides, Leather & Furs, Home Supplies, Industrial Supplies, Machinery & Electronics, Mineral Products, Miscellaneous, Plastics & Rubbers, Services, Stone, Glass & Jewelry, Telecommunications, Textiles, Transportation, Vegetables, Wood

Home - Companies - Products - Trade Leads - About Us - Terms of Service - FAQ - Need Help? - Contact Us

@ Copyright 2002-2024, B2B.TradeHolding.com - All Rights Reserved. - Site Map
Quick Guide Top
Statistics: Companies: 641,400+, Trade Leads: 160,300+, Products: 104,200+, Contacts / Replies: 8,283,500+
There are currently 36995 users online browsing our B2B network. 16:32 GMT, Wednesday, December 4, 2024
Privacy Policy
Important Notice! TradeHolding.com B2B Network does not provide an escrow service! Any member who asks you to pay for their products by Western Union to an agent of "TradeHolding.com B2B Network" is fraud and should be immediately reported to us. Do not pay anything to any member who states your money will be added to TradeHolding.com safety deposit account!
All Trade Leads / Offers / Products / Company Profiles / Images and other user-posted contents are posted by the user and B2B TradeHolding.com and TradeHolding.com B2B Network shall not be held liable for any such content. However, TradeHolding.com B2B Network respects the intellectual property, copyright, trademark, trade secret or any other personal or proprietary third party rights and expects the same from others. For concerns, please contact us.